Structure of PDB 8ovj Chain SS

Receptor sequence
>8ovjSS (length=54) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]
LDQWRSRQKIGMGKGARCCVICSNQKALIRKYELNVCRQCFRENAEHIGF
TKLR
3D structure
PDB8ovj Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
ChainSS
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna SS Q6 W7 R8 S9 R10 Q11 M15 K17 G18 R20 C25 N27 K29 R33 Y35 R41 Q42 R45 E46 R57 Q3 W4 R5 S6 R7 Q8 M12 K14 G15 R17 C22 N24 K26 R30 Y32 R38 Q39 R42 E43 R54
BS02 ZN SS C22 C25 C43 C19 C22 C40
BS03 MG SS N27 K29 N24 K26
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ovj, PDBe:8ovj, PDBj:8ovj
PDBsum8ovj
PubMed38722744
UniProtQ4Q817

[Back to BioLiP]