Structure of PDB 8k82 Chain SS

Receptor sequence

>8k82SS (length=145) Species: 4932 (Saccharomyces cerevisiae)

SLVVQEQGSFQHILRLLNTNVDGNIKIVYALTTIKGVGRRYSNLVCKKAD
VDLHKRAGELTQEELERIVQIMQNPTHYKIPAWFLNRQNDITDGKDYHTL
ANNVESKLRDDLERLKKIRAHRGIRHFWGLRVRGQHTKTTGRRRA

3D structure

• PDB: 8k82 Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
• Chain: SS
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SS	Y30 K36 G37 V38 G39 R40 R41 Y42 R57 W84 F85 N87 Q89 N90 H122 R123 H127 R132 V133 R134 G135 Q136 H137 T138 K139 T140 T141 R143	Y29 K35 G36 V37 G38 R39 R40 Y41 R56 W83 F84 N86 Q88 N89 H121 R122 H126 R131 V132 R133 G134 Q135 H136 T137 K138 T139 T140 R142

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000054 ribosomal subunit export from nucleus
• GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8k82, PDBe:8k82, PDBj:8k82
• PDBsum: 8k82
• PubMed: 38942792
• UniProt: P0CX55|RS18A_YEAST Small ribosomal subunit protein uS13A (Gene Name=RPS18A)