Structure of PDB 7n30 Chain SS

Receptor sequence
>7n30SS (length=82) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
RSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAVH
NGRQHVPVFVTDEMVGHKLGEFAPTRTYRGHA
3D structure
PDB7n30 Structural basis of early translocation events on the ribosome.
ChainSS
Resolution2.66 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna SS R3 S4 L5 K6 K7 F10 H14 K18 W34 R36 R37 G54 R55 K70 G72 E73 T77 R78 T79 Y80 R81 H83 R1 S2 L3 K4 K5 F8 H12 K16 W32 R34 R35 G52 R53 K68 G70 E71 T75 R76 T77 Y78 R79 H81
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7n30, PDBe:7n30, PDBj:7n30
PDBsum7n30
PubMed34234344
UniProtP0A7U3|RS19_ECOLI Small ribosomal subunit protein uS19 (Gene Name=rpsS)

[Back to BioLiP]