Structure of PDB 6zj3 Chain SS

Receptor sequence
>6zj3SS (length=52) Species: 3039 (Euglena gracilis) [Search protein sequence]
KDIWRSHPGRGRGTRRCRISGNRHGIIRKYGLMMTRREFREIAGDIGFVK
YN
3D structure
PDB6zj3 Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.
ChainSS
Resolution3.15 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna SS I6 W7 R8 H10 P11 G12 R13 G14 R15 G16 R18 S23 N25 R26 H27 I30 R31 K32 Y33 M36 R39 R40 E41 R43 E44 K53 Y54 N55 I3 W4 R5 H7 P8 G9 R10 G11 R12 G13 R15 S20 N22 R23 H24 I27 R28 K29 Y30 M33 R36 R37 E38 R40 E41 K50 Y51 N52
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 08:48:19 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6zj3', asym_id = 'SS', title = 'Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6zj3', asym_id='SS', title='Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0008270', uniprot = '', pdbid = '6zj3', asym_id = 'SS'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0008270', uniprot='', pdbid='6zj3', asym_id='SS')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>