Structure of PDB 6ywy Chain SS

Receptor sequence
>6ywySS (length=81) Species: 5141 (Neurospora crassa) [Search protein sequence]
KRSVWKGPHIVPLPIQRPEPGKKIAPIRTQARSATILPNFVGLKFQVHNG
KDYIDLTVTEEMVGHKLGEFSATRKPFIWGK
3D structure
PDB6ywy Analysis of translating mitoribosome reveals functional characteristics of translation in mitochondria of fungi.
ChainSS
Resolution3.05 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna SS K9 R10 S11 V12 W13 K14 H17 Q38 R40 S41 G58 K59 K74 G76 T81 R82 K83 F85 W87 K1 R2 S3 V4 W5 K6 H9 Q30 R32 S33 G50 K51 K66 G68 T73 R74 K75 F77 W79
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 07:19:29 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6ywy', asym_id = 'SS', title = 'Analysis of translating mitoribosome reveals fun...eristics of translation in mitochondria of fungi.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6ywy', asym_id='SS', title='Analysis of translating mitoribosome reveals fun...eristics of translation in mitochondria of fungi.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003723,0003735,0005840,0006412', uniprot = '', pdbid = '6ywy', asym_id = 'SS'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0005840,0006412', uniprot='', pdbid='6ywy', asym_id='SS')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>