Structure of PDB 6t7t Chain SS

Receptor sequence

>6t7tSS (length=145) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

SLVVQEQGSFQHILRLLNTNVDGNIKIVYALTTIKGVGRRYSNLVCKKAD
VDLHKRAGELTQEELERIVQIMQNPTHYKIPAWFLNRQNDITDGKDYHTL
ANNVESKLRDDLERLKKIRAHRGIRHFWGLRVRGQHTKTTGRRRA

3D structure

PDB

6t7t Molecular mechanism of translational stalling by inhibitory codon combinations and poly(A) tracts.

Chain

Resolution

3.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SS	K27 Y30 G37 V38 G39 R40 R41 Y42 R57 W84 F85 N87 R88 Q89 L109 H122 R123 R126 R132 V133 R134 Q136 H137 T138 K139 T140 T141 G142 R143 R144	K26 Y29 G36 V37 G38 R39 R40 Y41 R56 W83 F84 N86 R87 Q88 L108 H121 R122 R125 R131 V132 R133 Q135 H136 T137 K138 T139 T140 G141 R142 R143

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000054	ribosomal subunit export from nucleus
GO:0000447	endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6t7t, PDBe:6t7t, PDBj:6t7t
PDBsum	6t7t
PubMed	31858614
UniProt	P0CX55\|RS18A_YEAST Small ribosomal subunit protein uS13A (Gene Name=RPS18A)