Structure of PDB 6t7t Chain SS

Receptor sequence
>6t7tSS (length=145) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
SLVVQEQGSFQHILRLLNTNVDGNIKIVYALTTIKGVGRRYSNLVCKKAD
VDLHKRAGELTQEELERIVQIMQNPTHYKIPAWFLNRQNDITDGKDYHTL
ANNVESKLRDDLERLKKIRAHRGIRHFWGLRVRGQHTKTTGRRRA
3D structure
PDB6t7t Molecular mechanism of translational stalling by inhibitory codon combinations and poly(A) tracts.
ChainSS
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000054 ribosomal subunit export from nucleus
GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6t7t, PDBe:6t7t, PDBj:6t7t
PDBsum6t7t
PubMed31858614
UniProtP0CX55|RS18A_YEAST Small ribosomal subunit protein uS13A (Gene Name=RPS18A)

[Back to BioLiP]