Structure of PDB 5wlc Chain SS

Receptor sequence
>5wlcSS (length=197) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]
QRIQQRHDRKAAYEISRQEVSKWNDIVQQNRRADHLIFPLNKPTEHNHAS
AFTRTQDVPQTELQEKVDQVLQESNAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAANVIINEKVNKKNLKYQSSAVPFP
FENREQYERSLRMPIGQEWTSRASHQELIKPRIMTKPGQVIDPLKAP
3D structure
PDB5wlc The complete structure of the small-subunit processome.
ChainSS
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna SS E320 H321 N322 H323 T328 E833 K834 V835 K837 K838 R872 Q876 K880 M884 K886 E45 H46 N47 H48 T53 E133 K134 V135 K137 K138 R172 Q176 K180 M184 K186
BS02 rna SS Q303 R307 F849 Q28 R32 F149
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0005515 protein binding
GO:0005524 ATP binding
Biological Process
GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0032040 small-subunit processome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5wlc, PDBe:5wlc, PDBj:5wlc
PDBsum5wlc
PubMed28945246
UniProtQ04500|UTP14_YEAST U3 small nucleolar RNA-associated protein 14 (Gene Name=UTP14)

[Back to BioLiP]