Structure of PDB 3j9z Chain SS

Receptor sequence
>3j9zSS (length=91) Species: 562 (Escherichia coli) [Search protein sequence]
PRSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAV
HNGRQHVPVFVTDEMVGHKLGEFAPTRTYRGHAADKKAKKK
3D structure
PDB3j9z Activation of GTP hydrolysis in mRNA-tRNA translocation by elongation factor G.
ChainSS
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna SS P1 R2 S3 K5 K6 F9 K16 K17 R31 W33 R35 R36 H51 G53 R54 K69 G71 T76 R77 T78 R80 G81 A83 A84 D85 K89 P1 R2 S3 K5 K6 F9 K16 K17 R31 W33 R35 R36 H51 G53 R54 K69 G71 T76 R77 T78 R80 G81 A83 A84 D85 K89
BS02 rna SS H82 K90 K91 H82 K90 K91
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j9z, PDBe:3j9z, PDBj:3j9z
PDBsum3j9z
PubMed26229983
UniProtP0A7U3|RS19_ECOLI Small ribosomal subunit protein uS19 (Gene Name=rpsS)

[Back to BioLiP]