Structure of PDB 7qca Chain SR0

Receptor sequence
>7qcaSR0 (length=119) Species: 1358809 (Spraguea lophii 42_110) [Search protein sequence]
GQIKGKSVRTASKVIVERYFNRLTNDFYDNRNVVIDVAEIRSKKLRNKVS
GCVTKLYKRVKKNGVPGLYIKEHEEEREKKESFIPKISILDEDKVEVDEV
TMEMINQYEINGDYVLAKK
3D structure
PDB7qca Spraguea lophii ribosome
ChainSR0
Resolution2.79 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna SR0 G2 Q3 I4 K5 K7 R10 F28 Y29 R32 S43 K44 K45 L46 N48 K56 R60 G1 Q2 I3 K4 K6 R9 F27 Y28 R31 S42 K43 K44 L45 N47 K55 R59
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Thu May 8 21:41:17 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1471                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1472         else:
=> 1473             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1474     
   1475     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7qca', asym_id = 'SR0', title = 'Spraguea lophii ribosome'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7qca', asym_id='SR0', title='Spraguea lophii ribosome')
    840 
    841     if go:
=>  842         display_go(go,uniprot,pdbid,asym_id)
    843     return pubmed,uniprot
    844 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '7qca', asym_id = 'SR0'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='7qca', asym_id='SR0')
    481         '''.replace("$namespace_link",namespace_link
    482           ).replace("$namespace",namespace
=>  483           ).replace("$uniprot",u
    484         ))
    485         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>