Structure of PDB 8fkr Chain SR

Receptor sequence

>8fkrSR (length=428) Species: 9606 (Homo sapiens) [Search protein sequence]

AHYNFKKITVVPSAKDFIDLTLSKTQRKTPTVIHKHYQIHRIRHFYMRKV
KFTQQNYHDRLSQILTDFPKLDDIHPFYADLMNILYDKDHYKLALGQINI
AKNLVDNVAKDYVRLMKYGDSLYRCKQLKRAALGRMCTVIKRQKQSLEYL
EQVRQHLSRLPTIDPNTRTLLLCGYPNVGKSSFINKVTRADVDVQPYAFT
TKSLFVGHMDYKYLRWQVVDTPGILDHPLEDRNTIEMQAITALAHLRAAV
LYVMDLSEQCGHGLREQLELFQNIRPLFINKPLIVVANKCDVKRIAELSE
DDQKIFTDLQSEGFPVIETSTLTEEGVIKVKTEACDRLLAHRVENRLHLA
IPTRRDDKERPPFIPEGVDYILDLQKYWDLMNLSEKHDKIPEIWEGHNIA
DYIDPAIMKKLEELEKEEELRTAAGEYD

3D structure

PDB

8fkr Principles of human pre-60 S biogenesis.

Chain

Resolution

2.89 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SR	K7 L21 L23 S24 Q27 K36 L66 P70 K71 L96 Q98 I101 L105 K127 Q128 K130 R131 A132 L134 G135 R136 V140 R143 Q144 R155 R160 T163 R190 Y198 F200 V207 H209 I236	K6 L20 L22 S23 Q26 K35 L65 P69 K70 L95 Q97 I100 L104 K126 Q127 K129 R130 A131 L133 G134 R135 V139 R142 Q143 R154 R159 T162 R189 Y197 F199 V206 H208 I235
BS02	GDP	SR	N178 G180 K181 S182 S183 K290 S321 T322 L323	N177 G179 K180 S181 S182 K289 S320 T321 L322

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003924	GTPase activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:1990275	preribosome binding

	Biological Process
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0001649	osteoblast differentiation
GO:0008156	negative regulation of DNA replication
GO:0008285	negative regulation of cell population proliferation
GO:0022408	negative regulation of cell-cell adhesion
GO:0030336	negative regulation of cell migration
GO:0031397	negative regulation of protein ubiquitination
GO:0033342	negative regulation of collagen binding
GO:0042254	ribosome biogenesis
GO:0042273	ribosomal large subunit biogenesis
GO:0050821	protein stabilization

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0016020	membrane
GO:0031965	nuclear membrane
GO:0048471	perinuclear region of cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8fkr, PDBe:8fkr, PDBj:8fkr
PDBsum	8fkr
PubMed	37410842
UniProt	Q9BZE4\|GTPB4_HUMAN GTP-binding protein 4 (Gene Name=GTPBP4)

[Back to BioLiP]