Structure of PDB 8y0u Chain SQ

Receptor sequence

>8y0uSQ (length=139) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

AVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVEPEILRFKVYEPL
LLVGLDKFSNIDIRVRVTGGGHVSQVYAIRQAIAKGLVAYHQKYVDEQSK
NELKKAFTSYDRTLLIADSRRPEPKKFGGKGARSRFQKS

3D structure

PDB

8y0u dormant ribosome with STM1

Chain

Resolution

3.59 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SQ	Q8 F10 K14 S15 K30 R66 R68 G72 G73 H74 V75 R114 S121 R122 R123 P124 E125 K127 K128 F129 G133 A134 R135 S136 F138 Q139 K140	Q6 F8 K12 S13 K28 R64 R66 G70 G71 H72 V73 R112 S119 R120 R121 P122 E123 K125 K126 F127 G131 A132 R133 S134 F136 Q137 K138
BS02	MG	SQ	K127 G131 K132	K125 G129 K130

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation
GO:0006413	translational initiation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0030686	90S preribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8y0u, PDBe:8y0u, PDBj:8y0u
PDBsum	8y0u
PubMed	38698775
UniProt	P0CX51\|RS16A_YEAST Small ribosomal subunit protein uS9A (Gene Name=RPS16A)