Structure of PDB 8k82 Chain SQ

Receptor sequence

>8k82SQ (length=141) Species: 4932 (Saccharomyces cerevisiae)

AVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVEPEILRFKVYEPL
LLVGLDKFSNIDIRVRVTGGGHVSQVYAIRQAIAKGLVAYHQKYVDEQSK
NELKKAFTSYDRTLLIADSRRPEPKKFGGKGARSRFQKSYR

3D structure

• PDB: 8k82 Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
• Chain: SQ
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SQ	Q8 F10 K14 S15 V19 H21 K30 G33 E40 E42 R66 R68 G71 G72 G73 H74 V75 S76 I118 S121 R122 R123 P124 E125 P126 K127 K128 F129 G130 K132 G133 A134 R135 S136 F138 Q139 K140 S141 Y142 R143	Q6 F8 K12 S13 V17 H19 K28 G31 E38 E40 R64 R66 G69 G70 G71 H72 V73 S74 I116 S119 R120 R121 P122 E123 P124 K125 K126 F127 G128 K130 G131 A132 R133 S134 F136 Q137 K138 S139 Y140 R141

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006413 translational initiation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:0030686 90S preribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8k82, PDBe:8k82, PDBj:8k82
• PDBsum: 8k82
• PubMed: 38942792
• UniProt: P0CX51|RS16A_YEAST Small ribosomal subunit protein uS9A (Gene Name=RPS16A)