Structure of PDB 8k2a Chain SQ

Receptor sequence
>8k2aSQ (length=107) Species: 9606 (Homo sapiens) [Search protein sequence]
RSSVHARWIVGKVIGTKMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDA
LQQCTVGDIVLLRALPVPRAKHVKHELAEIVFKVGKVIDPVTGKPCAGTT
YLESPLS
3D structure
PDB8k2a Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
ChainSQ
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna SQ R5 S7 H9 M22 Q23 K24 T25 K27 Y38 R46 K47 F50 R73 A74 K75 H76 K78 R1 S3 H5 M18 Q19 K20 T21 K23 Y34 R42 K43 F46 R69 A70 K71 H72 K74
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8k2a, PDBe:8k2a, PDBj:8k2a
PDBsum8k2a
PubMed38942792
UniProtQ9Y2R5|RT17_HUMAN Small ribosomal subunit protein uS17m (Gene Name=MRPS17)

[Back to BioLiP]