Structure of PDB 8brm Chain SQ

Receptor sequence

>8brmSQ (length=125) Species: 184922 (Giardia lamblia ATCC 50803) [Search protein sequence]

AFAVCHIYAGKNDTFIHVTDLSGRETIGRVSGGMKVKRHCDEPSAYAAMQ
ATQDLIEIITDRGITAVHIKIRADGGTGKRVYGQGGSAAIRALVRGGIKI
GRIEDSTPIPTDRTRHKGGRRGRRL

3D structure

PDB

8brm Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.

Chain

Resolution

3.33 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SQ	K37 N38 F41 H43 G49 R50 E51 T52 R55 S57 G59 M60 H65 C66 E68 R88 R98 P134 I135 P136 T137 D138 R139 T140 R141 H142 K143 G145 R146 R147 R149 R150 L151	K11 N12 F15 H17 G23 R24 E25 T26 R29 S31 G33 M34 H39 C40 E42 R62 R72 P108 I109 P110 T111 D112 R113 T114 R115 H116 K117 G119 R120 R121 R123 R124 L125

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links