Structure of PDB 8yop Chain SP

Receptor sequence
>8yopSP (length=129) Species: 9606 (Homo sapiens) [Search protein sequence]
RTFRKFTYRGVDLDQLLDMSYEQLMQLYSARQRRRLNRGLRRKQHSLLKR
LRKAKKEAPPMEKPEVVKTHLRDMIILPEMVGSMVGVYNGKTFNQVEIKP
EMIGHYLGEFSITYKPVKHGRPGIGATHS
3D structure
PDB8yop Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
ChainSP
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0097371 MDM2/MDM4 family protein binding
GO:1990948 ubiquitin ligase inhibitor activity
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0000056 ribosomal small subunit export from nucleus
GO:0001649 osteoblast differentiation
GO:0002181 cytoplasmic translation
GO:0006364 rRNA processing
GO:0006412 translation
GO:0042274 ribosomal small subunit biogenesis
GO:0097421 liver regeneration
GO:1901798 positive regulation of signal transduction by p53 class mediator
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005925 focal adhesion
GO:0016020 membrane
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0045202 synapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8yop, PDBe:8yop, PDBj:8yop
PDBsum8yop
PubMed38942792
UniProtP62841|RS15_HUMAN Small ribosomal subunit protein uS19 (Gene Name=RPS15)

[Back to BioLiP]