Structure of PDB 8y0w Chain SP

Receptor sequence

>8y0wSP (length=121) Species: 9606 (Homo sapiens) [Search protein sequence]

TYRGVDLDQLLDMSYEQLMQLYSARQRRRLNRGLRRKQHSLLKRLRKAKK
EAPPMEKPEVVKTHLRDMIILPEMVGSMVGVYNGKTFNQVEIKPEMIGHY
LGEFSITYKPVKHGRPGIGAT

3D structure

PDB

8y0w dormant ribosome with eIF5A, eEF2 and SERBP1

Chain

Resolution

3.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SP	S38 A39 R40 R42 R43 R44 R47 R50 R51 K52 R59 K77 T78 H79 R81 D82 Y97 G99 K100 Y115 E118 T122 Y123 K124 V126 K127 H128 G129 P131 G132 G134 A135 T136	S23 A24 R25 R27 R28 R29 R32 R35 R36 K37 R44 K62 T63 H64 R66 D67 Y82 G84 K85 Y100 E103 T107 Y108 K109 V111 K112 H113 G114 P116 G117 G119 A120 T121

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0097371	MDM2/MDM4 family protein binding
GO:1990948	ubiquitin ligase inhibitor activity

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0000056	ribosomal small subunit export from nucleus
GO:0001649	osteoblast differentiation
GO:0002181	cytoplasmic translation
GO:0006364	rRNA processing
GO:0006412	translation
GO:0042274	ribosomal small subunit biogenesis
GO:0097421	liver regeneration
GO:1901798	positive regulation of signal transduction by p53 class mediator

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0005925	focal adhesion
GO:0015935	small ribosomal subunit
GO:0016020	membrane
GO:0022626	cytosolic ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0045202	synapse
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8y0w, PDBe:8y0w, PDBj:8y0w
PDBsum	8y0w
PubMed	38698775
UniProt	P62841\|RS15_HUMAN Small ribosomal subunit protein uS19 (Gene Name=RPS15)