Structure of PDB 8y0u Chain SP

Receptor sequence
>8y0uSP (length=117) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
KTHSYRGVDLEKLLEMSTEDFVKLAPARVRRRFARGMTSKPAGFMKKLRA
AKLAAPENEKPAPVRTHMRNMIIVPEMIGSVVGIYNGKAFNQVEIRPEML
GHYLGEFSITYTPVRHG
3D structure
PDB8y0u dormant ribosome with STM1
ChainSP
Resolution3.59 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna SP P38 A39 R40 R42 R43 R44 R47 A54 R77 T78 H79 N82 Y97 G99 K100 F102 Y115 G117 E118 T122 T124 V126 H128 P26 A27 R28 R30 R31 R32 R35 A42 R65 T66 H67 N70 Y85 G87 K88 F90 Y103 G105 E106 T110 T112 V114 H116
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0000054 ribosomal subunit export from nucleus
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8y0u, PDBe:8y0u, PDBj:8y0u
PDBsum8y0u
PubMed38698775
UniProtQ01855|RS15_YEAST Small ribosomal subunit protein uS19 (Gene Name=RPS15)

[Back to BioLiP]