Structure of PDB 8xsz Chain SP

Receptor sequence

>8xszSP (length=129) Species: 9606 (Homo sapiens) [Search protein sequence]

RTFRKFTYRGVDLDQLLDMSYEQLMQLYSARQRRRLNRGLRRKQHSLLKR
LRKAKKEAPPMEKPEVVKTHLRDMIILPEMVGSMVGVYNGKTFNQVEIKP
EMIGHYLGEFSITYKPVKHGRPGIGATHS

3D structure

PDB

8xsz Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.

Chain

Resolution

3.2 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SP	R18 S38 A39 R40 R42 R43 R47 R51 R59 K77 H79 R81 D82 Y97 N98 G99 K100 Y115 I121 T122 Y123 K124 V126 K127 H128 G129 R130 P131 G132 G134 A135	R9 S29 A30 R31 R33 R34 R38 R42 R50 K68 H70 R72 D73 Y88 N89 G90 K91 Y106 I112 T113 Y114 K115 V117 K118 H119 G120 R121 P122 G123 G125 A126
BS02	rna	SP	T136 H137 S138	T127 H128 S129

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0097371	MDM2/MDM4 family protein binding
GO:1990948	ubiquitin ligase inhibitor activity

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0000056	ribosomal small subunit export from nucleus
GO:0001649	osteoblast differentiation
GO:0002181	cytoplasmic translation
GO:0006364	rRNA processing
GO:0006412	translation
GO:0042274	ribosomal small subunit biogenesis
GO:0097421	liver regeneration
GO:1901798	positive regulation of signal transduction by p53 class mediator

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0005925	focal adhesion
GO:0016020	membrane
GO:0022626	cytosolic ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0045202	synapse
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8xsz, PDBe:8xsz, PDBj:8xsz
PDBsum	8xsz
PubMed	38942792
UniProt	P62841\|RS15_HUMAN Small ribosomal subunit protein uS19 (Gene Name=RPS15)