Structure of PDB 8k82 Chain SP

Receptor sequence
>8k82SP (length=119) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
THSYRGVDLEKLLEMSTEDFVKLAPARVRRRFARGMTSKPAGFMKKLRAA
KLAAPENEKPAPVRTHMRNMIIVPEMIGSVVGIYNGKAFNQVEIRPEMLG
HYLGEFSITYTPVRHGRAG
3D structure
PDB8k82 Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
ChainSP
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna SP P38 A39 R40 R42 R43 R44 R47 A54 K59 R77 T78 H79 R81 N82 Y97 G99 K100 Y115 G117 E118 T122 Y123 T124 V126 H128 P25 A26 R27 R29 R30 R31 R34 A41 K46 R64 T65 H66 R68 N69 Y84 G86 K87 Y102 G104 E105 T109 Y110 T111 V113 H115
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0000054 ribosomal subunit export from nucleus
GO:0002181 cytoplasmic translation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8k82, PDBe:8k82, PDBj:8k82
PDBsum8k82
PubMed38942792
UniProtQ01855|RS15_YEAST Small ribosomal subunit protein uS19 (Gene Name=RPS15)

[Back to BioLiP]