Structure of PDB 7d4i Chain SP

Receptor sequence
>7d4iSP (length=116) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
SQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAA
MLAAQDVAAKCKEVGITAVHVKIRATGGTRTKTPGPGGQAALRALARSGL
RIGRIEDVTPVPSDST
3D structure
PDB7d4i Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
ChainSP
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna SP R18 N24 D25 F27 H29 G35 K36 E37 T38 R41 T43 G45 M46 D51 R52 E54 R84 V121 P122 S123 D124 R8 N14 D15 F17 H19 G25 K26 E27 T28 R31 T33 G35 M36 D41 R42 E44 R74 V111 P112 S113 D114
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
GO:0006364 rRNA processing
GO:0006412 translation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0030686 90S preribosome
GO:0032040 small-subunit processome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7d4i, PDBe:7d4i, PDBj:7d4i
PDBsum7d4i
PubMed
UniProtP06367|RS14A_YEAST Small ribosomal subunit protein uS11A (Gene Name=RPS14A)

[Back to BioLiP]