Structure of PDB 6om0 Chain SP

Receptor sequence

>6om0SP (length=127) Species: 9606 (Homo sapiens)

RTFRKFTYRGVDLDQLLDMSYEQLMQLYSARQRRRLNRGLRRKQHSLLKR
LRKAKKEAPPMEKPEVVKTHLRDMIILPEMVGSMVGVYNGKTFNQVEIKP
EMIGHYLGEFSITYKPVKHGRPGIGAT

3D structure

• PDB: 6om0 Structural basis for selective stalling of human ribosome nascent chain complexes by a drug-like molecule.
• Chain: SP
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SP	S38 A39 R40 R42 R43 R44 R47 R50 R51 R59 K77 H79 R81 D82 Y97 N98 G99 K100 Y115 G117 E118 T122 Y123 V126 H128 G129 R130 G134 A135	S29 A30 R31 R33 R34 R35 R38 R41 R42 R50 K68 H70 R72 D73 Y88 N89 G90 K91 Y106 G108 E109 T113 Y114 V117 H119 G120 R121 G125 A126
BS02	rna	SP	A135 T136	A126 T127

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit

External links

• PDB: RCSB:6om0, PDBe:6om0, PDBj:6om0
• PDBsum: 6om0
• PubMed: 31160784
• UniProt: P62841|RS15_HUMAN Small ribosomal subunit protein uS19 (Gene Name=RPS15)