Structure of PDB 6ole Chain SP

Receptor sequence
>6oleSP (length=127) Species: 9606 (Homo sapiens) [Search protein sequence]
RTFRKFTYRGVDLDQLLDMSYEQLMQLYSARQRRRLNRGLRRKQHSLLKR
LRKAKKEAPPMEKPEVVKTHLRDMIILPEMVGSMVGVYNGKTFNQVEIKP
EMIGHYLGEFSITYKPVKHGRPGIGAT
3D structure
PDB6ole Structural basis for selective stalling of human ribosome nascent chain complexes by a drug-like molecule.
ChainSP
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna SP S38 A39 R40 R42 R43 R44 R47 R50 R51 R59 H79 R81 D82 Y97 G99 K100 Y115 G117 E118 T122 Y123 K124 V126 G129 R130 G132 G134 A135 S29 A30 R31 R33 R34 R35 R38 R41 R42 R50 H70 R72 D73 Y88 G90 K91 Y106 G108 E109 T113 Y114 K115 V117 G120 R121 G123 G125 A126
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ole, PDBe:6ole, PDBj:6ole
PDBsum6ole
PubMed31160784
UniProtP62841|RS15_HUMAN Small ribosomal subunit protein uS19 (Gene Name=RPS15)

[Back to BioLiP]