Structure of PDB 3j7r Chain SP

Receptor sequence
>3j7rSP (length=96) Species: 9823 (Sus scrofa) [Search protein sequence]
VEQKKKRTFRKFTYRGVDLDQLLDMSYEQLMQLYSARQRRRLNRGLRRKQ
HSLLKRLRKAKKEAPPMEKPEVVKTHLRDMIILPEMVGSMVGVYNG
3D structure
PDB3j7r Structure of the Mammalian ribosome-sec61 complex to 3.4 a resolution.
ChainSP
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna SP R18 A39 R40 R44 R47 G48 R50 S55 L56 R59 K62 K77 H79 R81 D82 Y97 G99 R15 A36 R37 R41 R44 G45 R47 S52 L53 R56 K59 K74 H76 R78 D79 Y94 G96
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:0098556 cytoplasmic side of rough endoplasmic reticulum membrane
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j7r, PDBe:3j7r, PDBj:3j7r
PDBsum3j7r
PubMed24930395
UniProtP62844|RS15_PIG Small ribosomal subunit protein uS19 (Gene Name=RPS15)

[Back to BioLiP]