Structure of PDB 8xt0 Chain SO

Receptor sequence

>8xt0SO (length=164) Species: 9606 (Homo sapiens)

DPPPSTLLKDYQNVPGIEKVDDVVKRLLSLEMANKKEMLKIKQEQFMKKI
VANPEDTRSLEARIIALSVKIRSYEEHLEKHRKDKAHKRYLLMSIDQRKK
MLKNLRNTNYDVFEKICWGLGIEYTFPPLYYRRAHRRFVTKKALCIRVFQ
ETQKLKKRRRALKA

3D structure

• PDB: 8xt0 Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
• Chain: SO
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SO	K100 K101 R123 R128 L132 K135 Y139 H142 H146 R147 K148 D149 K150 H152 K153 R154 Y155 L157 M158 D161 Q162 K165 K168 Y195 Y196 R197 H200 R201 R202 F203 K206 C210 F214 R225	K35 K36 R58 R63 L67 K70 Y74 H77 H81 R82 K83 D84 K85 H87 K88 R89 Y90 L92 M93 D96 Q97 K100 K103 Y130 Y131 R132 H135 R136 R137 F138 K141 C145 F149 R160

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005759 mitochondrial matrix
• GO:0005761 mitochondrial ribosome
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8xt0, PDBe:8xt0, PDBj:8xt0
• PDBsum: 8xt0
• PubMed: 38942792
• UniProt: P82914|RT15_HUMAN Small ribosomal subunit protein uS15m (Gene Name=MRPS15)