Structure of PDB 8rxx Chain SO

Receptor sequence

>8rxxSO (length=136) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]

AYGPNVKKGDLVYGVVHIFASFNDTFVHVTDMSGRETYVKVTGGMKVKAD
RDESSPYAAMMAAQDVVARCKECGINALHVKMRAVGGVRTKSPGPGAQAA
LRALARAGMKIGRIEDVTPIPTDSTRRKGSRRGRRL

3D structure

PDB

8rxx Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.

Chain

Resolution

2.97 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SO	N31 D32 F34 H36 S41 G42 R43 E44 T45 K48 T50 G52 M53 D58 R59 R91 G95 I128 P129 T130 D131 T133 R134 K136 G137 S138 R139 R140 R142 R143	N23 D24 F26 H28 S33 G34 R35 E36 T37 K40 T42 G44 M45 D50 R51 R83 G87 I120 P121 T122 D123 T125 R126 K128 G129 S130 R131 R132 R134 R135

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links