Structure of PDB 8bsj Chain SO

Receptor sequence

>8bsjSO (length=140) Species: 5741 (Giardia intestinalis) [Search protein sequence]

MSKTSGLYTARKLRTVRRVNRWADKKYRKAHLGTWLKANPLEGACMARGI
VTQKIGISAKQPNSAVRKAVRVQLTKNSKKITAFVPRDGSITYIDNNDEV
LVAGFGRAGRAVGDIPGCRFKVIKVAGIGLLALFLRKREK

3D structure

PDB

8bsj Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.

Chain

Resolution

6.49 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SO	M1 K3 T4 S5 G6 L7 Y8 T9 R11 K12 R17 R18 R21 A23 D24 L32 T34 W35 L36 A44 C45 M46 A47 R48 S58 A59 K60 Q61 N63 S64 A65 V66 R67 K68 R71 K76 R87 D88 G104 G106 R107 R110 V112 G113 D114 R119 K121 K124 A132 K137	M1 K3 T4 S5 G6 L7 Y8 T9 R11 K12 R17 R18 R21 A23 D24 L32 T34 W35 L36 A44 C45 M46 A47 R48 S58 A59 K60 Q61 N63 S64 A65 V66 R67 K68 R71 K76 R87 D88 G104 G106 R107 R110 V112 G113 D114 R119 K121 K124 A132 K137
BS02	rna	SO	Q61 P62	Q61 P62

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links