Structure of PDB 7xnx Chain SO

Receptor sequence
>7xnxSO (length=135) Species: 9606 (Homo sapiens) [Search protein sequence]
LGPQVAEGENVFGVCHIFASFNDTFVHVTDLSGKETICRVTGGMKVKADR
DESSPYAAMLAAQDVAQRCKELGITALHIKLRATGGNRTKTPGPGAQSAL
RALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL
3D structure
PDB7xnx A Dynamic rRNA Ribomethylome Drives Stemness in Acute Myeloid Leukemia.
ChainSO
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna SO N38 D39 F41 H43 G49 K50 E51 T52 R55 T57 G59 M60 K63 D65 R66 I135 P136 S137 D138 S139 R141 K143 R146 R147 R149 R150 N22 D23 F25 H27 G33 K34 E35 T36 R39 T41 G43 M44 K47 D49 R50 I119 P120 S121 D122 S123 R125 K127 R130 R131 R133 R134
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0045182 translation regulator activity
GO:0048027 mRNA 5'-UTR binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006417 regulation of translation
GO:0030218 erythrocyte differentiation
GO:0030490 maturation of SSU-rRNA
GO:0042274 ribosomal small subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005925 focal adhesion
GO:0014069 postsynaptic density
GO:0015935 small ribosomal subunit
GO:0016020 membrane
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0032040 small-subunit processome
GO:0045202 synapse
GO:0070062 extracellular exosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7xnx, PDBe:7xnx, PDBj:7xnx
PDBsum7xnx
PubMed36259929
UniProtP62263|RS14_HUMAN Small ribosomal subunit protein uS11 (Gene Name=RPS14)

[Back to BioLiP]