Structure of PDB 7wtn Chain SO

Receptor sequence
>7wtnSO (length=128) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
NSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYA
AMLAAQDVAAKCKEVGITAVHVKIRATGGTRTKTPGPGGQAALRALARSG
LRIGRIEDVTPVPSDSTRKKGGRRGRRL
3D structure
PDB7wtn The nucleoplasmic phase of pre-40S formation prior to nuclear export.
ChainSO
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna SO N24 D25 F27 H29 G35 E37 T38 R41 T43 G45 D51 V121 P122 S123 D124 S125 T126 R127 K129 G130 G131 R132 R133 R136 N15 D16 F18 H20 G26 E28 T29 R32 T34 G36 D42 V112 P113 S114 D115 S116 T117 R118 K120 G121 G122 R123 R124 R127
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
GO:0006364 rRNA processing
GO:0006412 translation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0030686 90S preribosome
GO:0032040 small-subunit processome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7wtn, PDBe:7wtn, PDBj:7wtn
PDBsum7wtn
PubMed36321656
UniProtP06367|RS14A_YEAST Small ribosomal subunit protein uS11A (Gene Name=RPS14A)

[Back to BioLiP]