Structure of PDB 7wtl Chain SO

Receptor sequence

>7wtlSO (length=128) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

NSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYA
AMLAAQDVAAKCKEVGITAVHVKIRATGGTRTKTPGPGGQAALRALARSG
LRIGRIEDVTPVPSDSTRKKGGRRGRRL

3D structure

PDB

7wtl In vitro structural maturation of an early stage pre-40S particle coupled with U3 snoRNA release and central pseudoknot formation.

Chain

Resolution

3.3 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SO	R18 N24 D25 F27 H29 G35 K36 E37 T38 R41 T43 G45 M46 D51 R52 R84 V121 P122 S123 D124 S125 T126 R127 K129 G130 G131 R132 R133	R9 N15 D16 F18 H20 G26 K27 E28 T29 R32 T34 G36 M37 D42 R43 R75 V112 P113 S114 D115 S116 T117 R118 K120 G121 G122 R123 R124

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006364	rRNA processing
GO:0006412	translation
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0030686	90S preribosome
GO:0032040	small-subunit processome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7wtl, PDBe:7wtl, PDBj:7wtl
PDBsum	7wtl
PubMed	36263816
UniProt	P06367\|RS14A_YEAST Small ribosomal subunit protein uS11A (Gene Name=RPS14A)