Structure of PDB 7d5s Chain SO

Receptor sequence

>7d5sSO (length=134) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

KGISSSAIPYSRNAPAWFKLSSESVIEQIVKYARKGLTPSQIGVLLRDAH
GVTQARVITGNKIMRILKSNGLAPEIPEDLYYLIKKAVSVRKHLERNRKD
KDAKFRLILIESRIHRLARYYRTVAVLPPNWKYE

3D structure

PDB

7d5s Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)

Chain

Resolution

4.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SO	K9 G10 I11 S12 S13 S14 A15 P17 S48 G51 R55 T61 K70 M72 D87 Y90 L91 K94 V98 H101 N105 K107 D108 K109 F113 R114 S120 R121 R124 L125 R127 Y128	K1 G2 I3 S4 S5 S6 A7 P9 S40 G43 R47 T53 K62 M64 D79 Y82 L83 K86 V90 H93 N97 K99 D100 K101 F105 R106 S112 R113 R116 L117 R119 Y120

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0070181	small ribosomal subunit rRNA binding

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0030686	90S preribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7d5s, PDBe:7d5s, PDBj:7d5s
PDBsum	7d5s
PubMed
UniProt	P05756\|RS13_YEAST Small ribosomal subunit protein uS15 (Gene Name=RPS13)