Structure of PDB 7cpu Chain SO

Receptor sequence

>7cpuSO (length=134) Species: 10090 (Mus musculus) [Search protein sequence]

GPQVAEGENVFGVCHIFASFNDTFVHVTDLSGKETICRVTGGMKVKADRD
ESSPYAAMLAAQDVAQRCKELGITALHIKLRATGGNRTKTPGPGAQSALR
ALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL

3D structure

PDB

7cpu A male germ-cell-specific ribosome controls male fertility.

Chain

Resolution

2.82 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SO	H32 N38 D39 F41 H43 G49 K50 T52 R55 T57 G59 M60 A64 D65 R66 R104 P134 I135 P136 S137 D138 S139 T140 R141 K143 G145 R146 R147 R149 R150 L151	H15 N21 D22 F24 H26 G32 K33 T35 R38 T40 G42 M43 A47 D48 R49 R87 P117 I118 P119 S120 D121 S122 T123 R124 K126 G128 R129 R130 R132 R133 L134

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0045182	translation regulator activity
GO:0048027	mRNA 5'-UTR binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0000122	negative regulation of transcription by RNA polymerase II
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0006417	regulation of translation
GO:0030218	erythrocyte differentiation
GO:0030490	maturation of SSU-rRNA
GO:0042274	ribosomal small subunit biogenesis
GO:0140236	translation at presynapse
GO:0140242	translation at postsynapse

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005829	cytosol
GO:0005840	ribosome
GO:0014069	postsynaptic density
GO:0015935	small ribosomal subunit
GO:0022626	cytosolic ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0032040	small-subunit processome
GO:0045202	synapse
GO:0098793	presynapse
GO:0098794	postsynapse
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7cpu, PDBe:7cpu, PDBj:7cpu
PDBsum	7cpu
PubMed	36517592
UniProt	P62264\|RS14_MOUSE Small ribosomal subunit protein uS11 (Gene Name=Rps14)