Structure of PDB 6t7i Chain SO

Receptor sequence
>6t7iSO (length=127) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
SQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAA
MLAAQDVAAKCKEVGITAVHVKIRATGGTRTKTPGPGGQAALRALARSGL
RIGRIEDVTPVPSDSTRKKGGRRGRRL
3D structure
PDB6t7i Molecular mechanism of translational stalling by inhibitory codon combinations and poly(A) tracts.
ChainSO
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna SO N24 D25 F27 H29 T38 R41 T43 G45 A50 D51 E54 R84 V121 P122 S123 D124 T126 R127 K129 G131 R132 R133 R135 R136 N14 D15 F17 H19 T28 R31 T33 G35 A40 D41 E44 R74 V111 P112 S113 D114 T116 R117 K119 G121 R122 R123 R125 R126
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
GO:0006364 rRNA processing
GO:0006412 translation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0030686 90S preribosome
GO:0032040 small-subunit processome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6t7i, PDBe:6t7i, PDBj:6t7i
PDBsum6t7i
PubMed31858614
UniProtP06367|RS14A_YEAST Small ribosomal subunit protein uS11A (Gene Name=RPS14A)

[Back to BioLiP]