Structure of PDB 8k82 Chain SN

Receptor sequence

>8k82SN (length=150) Species: 4932 (Saccharomyces cerevisiae)

GRMHSAGKGISSSAIPYSRNAPAWFKLSSESVIEQIVKYARKGLTPSQIG
VLLRDAHGVTQARVITGNKIMRILKSNGLAPEIPEDLYYLIKKAVSVRKH
LERNRKDKDAKFRLILIESRIHRLARYYRTVAVLPPNWKYESATASALVN

3D structure

• PDB: 8k82 Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
• Chain: SN
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SN	G2 R3 M4 H5 S6 G8 K9 G10 I11 S12 S13 S14 A15 I16 R20 S48 V52 R55 T61 Q62 R64 K70 M72 R73 Y90 K94 S97 H101 R104 K107 D108 K109 D110 K112 F113 R114 I116 S120 R121 R124 R127 Y128	G1 R2 M3 H4 S5 G7 K8 G9 I10 S11 S12 S13 A14 I15 R19 S47 V51 R54 T60 Q61 R63 K69 M71 R72 Y89 K93 S96 H100 R103 K106 D107 K108 D109 K111 F112 R113 I115 S119 R120 R123 R126 Y127
BS02	rna	SN	E119 H123 R127	E118 H122 R126

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation

Cellular Component

• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:0030686 90S preribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8k82, PDBe:8k82, PDBj:8k82
• PDBsum: 8k82
• PubMed: 38942792
• UniProt: P05756|RS13_YEAST Small ribosomal subunit protein uS15 (Gene Name=RPS13)