Structure of PDB 6t7t Chain SN

Receptor sequence

>6t7tSN (length=150) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

GRMHSAGKGISSSAIPYSRNAPAWFKLSSESVIEQIVKYARKGLTPSQIG
VLLRDAHGVTQARVITGNKIMRILKSNGLAPEIPEDLYYLIKKAVSVRKH
LERNRKDKDAKFRLILIESRIHRLARYYRTVAVLPPNWKYESATASALVN

3D structure

PDB

6t7t Molecular mechanism of translational stalling by inhibitory codon combinations and poly(A) tracts.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SN	R3 M4 H5 G8 K9 G10 I11 S12 S14 A15 I16 R20 S48 R55 T61 R64 K70 R73 K76 D87 Y90 K94 V98 H101 N105 K107 D108 K109 K112 F113 R114 I116 S120 R121 R124 R127 Y128	R2 M3 H4 G7 K8 G9 I10 S11 S13 A14 I15 R19 S47 R54 T60 R63 K69 R72 K75 D86 Y89 K93 V97 H100 N104 K106 D107 K108 K111 F112 R113 I115 S119 R120 R123 R126 Y127

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0070181	small ribosomal subunit rRNA binding

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0030686	90S preribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6t7t, PDBe:6t7t, PDBj:6t7t
PDBsum	6t7t
PubMed	31858614
UniProt	P05756\|RS13_YEAST Small ribosomal subunit protein uS15 (Gene Name=RPS13)

[Back to BioLiP]