Structure of PDB 7zjw Chain SM

Receptor sequence

>7zjwSM (length=224) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

AVGKNKRLTKKVVDPFSKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIAS
DGLKGRVFEVSLADLQNDEVAFRKFKLITEDVQGKNCLTNFHGMDLTRDK
MCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYAQHQ
QVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEKACQSIYPLHD
VFVRKVKMLKKPKFELGKLMELHG

3D structure

PDB

7zjw Structure of the mammalian ribosome as it decodes the selenocysteine UGA codon.

Chain

Resolution

2.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SM	A2 N6 K28 V114 K115 K116 W117 M120 H124 R136 F138 R146 N148 I150 R151 Y155 Q157 H158 Q159 R162 R165 Q202 S203 I204 Y205 P206 K214 K216	A1 N5 K19 V105 K106 K107 W108 M111 H115 R127 F129 R137 N139 I141 R142 Y146 Q148 H149 Q150 R153 R156 Q193 S194 I195 Y196 P197 K205 K207

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0030154	cell differentiation

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7zjw, PDBe:7zjw, PDBj:7zjw
PDBsum	7zjw
PubMed	35709277
UniProt	G1SS70\|RS3A_RABIT Small ribosomal subunit protein eS1 (Gene Name=RPS3A)

[Back to BioLiP]