Structure of PDB 5ndg Chain SM

Receptor sequence

>5ndgSM (length=135) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

PPKEIVKSNTSSKKADVPPPSADPSKARKNRPRPSGNEGAIRDKTAGRRN
NRSKDVTDSATTKKSNTRRATDRHSRTGKTDTKKKVNQGWGDDKKELSAE
KEAQADAAAEIAEDAAEAEDALNQQANNQFNKVPE

3D structure

PDB

5ndg Aminoglycoside interactions and impacts on the eukaryotic ribosome.

Chain

Resolution

3.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SM	R68 N71 R72 V76 A80 R89 A90 D92 R93 H94 S95 R96 K99 T100 T102 K104 Q108	R48 N51 R52 V56 A60 R69 A70 D72 R73 H74 S75 R76 K79 T80 T82 K84 Q88
BS02	rna	SM	K27 T30 S31 S32 K33 K34 S41 A42 D43 K46 A47 R48 K49	K7 T10 S11 S12 K13 K14 S21 A22 D23 K26 A27 R28 K29

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003677	DNA binding
GO:0003723	RNA binding
GO:0005515	protein binding
GO:0030371	translation repressor activity
GO:0042162	telomeric DNA binding
GO:0043022	ribosome binding
GO:0045142	triplex DNA binding
GO:0061770	translation elongation factor binding

	Biological Process
GO:0000723	telomere maintenance
GO:0006414	translational elongation
GO:0006417	regulation of translation
GO:0031929	TOR signaling
GO:0043066	negative regulation of apoptotic process
GO:0043558	regulation of translational initiation in response to stress
GO:0141014	ribosome hibernation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0048471	perinuclear region of cytoplasm

External links

PDB	RCSB:5ndg, PDBe:5ndg, PDBj:5ndg
PDBsum	5ndg
PubMed	29208708
UniProt	P39015\|STM1_YEAST Suppressor protein STM1 (Gene Name=STM1)