Structure of PDB 4u4z Chain SM

Receptor sequence

>4u4zSM (length=159) Species: 559292 (Saccharomyces cerevisiae S288C)

GNDVEDADVVVLPPKEIVKSNTSSKKADVPPPSADPSKARKNRPRPSGNE
GAIRDKTAGRRNNRSKDVTDSATTKKSNTRRATDRHSRTGKTDTKKKVNQ
GWGDDKKELSAEKEAQADAAAEIAEDAAEAEDALQDYLNQQANNQFNKVP
EAKKVELDA

3D structure

• PDB: 4u4z ?
• Chain: SM
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SM	R68 N71 R72 V76 S79 A80 K84 R89 A90 D92 R93 H94 S95 R96 K99 T100 T102 K103 K104 Q108 K115	R60 N63 R64 V68 S71 A72 K76 R81 A82 D84 R85 H86 S87 R88 K91 T92 T94 K95 K96 Q100 K107
BS02	rna	SM	T30 S31 S32 K34 S41 A42 D43 P44 K46 A47 R48 K49 R62	T22 S23 S24 K26 S33 A34 D35 P36 K38 A39 R40 K41 R54
BS03	MG	SM	N29 S31	N21 S23

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003677 DNA binding
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0030371 translation repressor activity
• GO:0042162 telomeric DNA binding
• GO:0043022 ribosome binding
• GO:0045142 triplex DNA binding
• GO:0061770 translation elongation factor binding

Biological Process

• GO:0000723 telomere maintenance
• GO:0006414 translational elongation
• GO:0006417 regulation of translation
• GO:0031929 TOR signaling
• GO:0043066 negative regulation of apoptotic process
• GO:0043558 regulation of translational initiation in response to stress
• GO:0141014 ribosome hibernation

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0048471 perinuclear region of cytoplasm

External links

• PDB: RCSB:4u4z, PDBe:4u4z, PDBj:4u4z
• PDBsum: 4u4z
• PubMed: 25209664
• UniProt: P39015|STM1_YEAST Suppressor protein STM1 (Gene Name=STM1)