Structure of PDB 8xsz Chain SL

Receptor sequence

>8xszSL (length=144) Species: 9606 (Homo sapiens) [Search protein sequence]

ADIQTERAYQKQPTIFQNKKRKLPRYYKNIGLGFKTPKEAIEGTYIDKKC
PFTGNVSIRGRILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMS
VHLSPCFRDVQIGDIVTVGECRPLSKTVRFNVLKVTKAAGTKKQ

3D structure

PDB

8xsz Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.

Chain

Resolution

3.2 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SL	E7 Q11 P14 T15 F17 Y36 G41 L42 K58 K59 N65 S67 I68 R69 R71 K79 K81 M82 Q83 R90 Y92 H94 R97 K98 Y99 K104 R105 H106 K107 N108 E130 R132 P133 S135 K136 T137 R139 F140 K152 K153	E6 Q10 P13 T14 F16 Y26 G31 L32 K48 K49 N55 S57 I58 R59 R61 K69 K71 M72 Q73 R80 Y82 H84 R87 K88 Y89 K94 R95 H96 K97 N98 E120 R122 P123 S125 K126 T127 R129 F130 K142 K143

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042274	ribosomal small subunit biogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0005925	focal adhesion
GO:0016020	membrane
GO:0022626	cytosolic ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0032040	small-subunit processome
GO:0045202	synapse
GO:0070062	extracellular exosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8xsz, PDBe:8xsz, PDBj:8xsz
PDBsum	8xsz
PubMed	38942792
UniProt	P62280\|RS11_HUMAN Small ribosomal subunit protein uS17 (Gene Name=RPS11)