Structure of PDB 8rxh Chain SL

Receptor sequence

>8rxhSL (length=144) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]

SYALKQVQTFGKKKTAIAVATVTKAAQCNIKVNGVPLQQILPDTLRAKIM
EAITVVGSKYYSRLRIDVAVHGGGQVSQAYAARQAIAKGLIAFFQKYHNE
VEKAALKDKFLAYDKFLLIADPRRCEPKKWGRHSARTRFTKSYR

3D structure

PDB

8rxh Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.

Chain

Resolution

2.93 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SL	Y7 Q11 Q13 K17 K18 K19 T20 I22 A30 A31 Q32 C33 N34 I35 K36 N38 L42 Q43 L46 P47 R51 M55 S67 G77 G78 G79 Q80 V81 S82 Q83 P127 R128 R129 C130 E131 P132 K133 K134 W135 G136 R137 S139 R141 T142 R143 F144 T145 K146 S147 Y148 R149	Y2 Q6 Q8 K12 K13 K14 T15 I17 A25 A26 Q27 C28 N29 I30 K31 N33 L37 Q38 L41 P42 R46 M50 S62 G72 G73 G74 Q75 V76 S77 Q78 P122 R123 R124 C125 E126 P127 K128 K129 W130 G131 R132 S134 R136 T137 R138 F139 T140 K141 S142 Y143 R144

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links