Structure of PDB 8ovj Chain SL

Receptor sequence

>8ovjSL (length=143) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]

YALKQVQTFGKKKTAIAVATVTKAAQCNIKVNGVPLQQILPDTLRAKIME
AITVVGSKYYSRLRIDVAVHGGGQVSQAYAARQAIAKGLIAFFQKYHNEV
EKAALKDKFLAYDKFLLIADPRRCEPKKWGRHSARTRFTKSYR

3D structure

PDB

8ovj Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.

Chain

Resolution

2.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SL	Y7 Q11 Q13 K19 T20 A30 C33 I35 K36 L42 Q43 S67 G77 G78 G79 V81 S82 Q83 R128 R129 C130 E131 P132 K133 K134 W135 R137 S139 R141 T142 R143 T145 K146 S147	Y1 Q5 Q7 K13 T14 A24 C27 I29 K30 L36 Q37 S61 G71 G72 G73 V75 S76 Q77 R122 R123 C124 E125 P126 K127 K128 W129 R131 S133 R135 T136 R137 T139 K140 S141

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links