Structure of PDB 8k2a Chain SL

Receptor sequence
>8k2aSL (length=108) Species: 9606 (Homo sapiens) [Search protein sequence]
ATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRKPKKPNSANRKC
CRVRLSTGREAVCFIPGEGHTLQEHQIVLVEGGRTQDLPGVKLTVVRGKY
DCGHVQKK
3D structure
PDB8k2a Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
ChainSL
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna SL A31 T32 N34 Q35 P42 K43 R44 R47 G54 P56 Q57 L58 K59 K71 K72 N74 S75 N77 R78 S86 G97 E98 E111 G112 Q116 K122 K129 H134 A1 T2 N4 Q5 P12 K13 R14 R17 G24 P26 Q27 L28 K29 K41 K42 N44 S45 N47 R48 S56 G67 E68 E81 G82 Q86 K92 K99 H104
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8k2a, PDBe:8k2a, PDBj:8k2a
PDBsum8k2a
PubMed38942792
UniProtO15235|RT12_HUMAN Small ribosomal subunit protein uS12m (Gene Name=MRPS12)

[Back to BioLiP]