Structure of PDB 8glp Chain SL

Receptor sequence

>8glpSL (length=146) Species: 9606 (Homo sapiens) [Search protein sequence]

ADIQTERAYQKQPTIFQNKKRVKLPRYYKNIGLGFKTPKEAIEGTYIDKK
CPFTGNVSIRGRILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNM
SVHLSPCFRDVQIGDIVTVGECRPLSKTVRFNVLKVTKAAGTKKQF

3D structure

PDB

8glp mRNA decoding in human is kinetically and structurally distinct from bacteria.

Chain

Resolution

1.67 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SL	E7 R8 A9 P14 T15 F17 K20 Y36 N39 G41 L42 K58 K59 G64 N65 S67 I68 R69 R71 K79 K81 M82 Q83 T85 V87 R89 R90 Y92 H94 K98 K104 R105 H106 K107 N108 E130 R132 P133 L134 S135 K136 T137 R139 F140 K152 F155	E6 R7 A8 P13 T14 F16 K19 Y27 N30 G32 L33 K49 K50 G55 N56 S58 I59 R60 R62 K70 K72 M73 Q74 T76 V78 R80 R81 Y83 H85 K89 K95 R96 H97 K98 N99 E121 R123 P124 L125 S126 K127 T128 R130 F131 K143 F146

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042274	ribosomal small subunit biogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0005925	focal adhesion
GO:0016020	membrane
GO:0022626	cytosolic ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0032040	small-subunit processome
GO:0045202	synapse
GO:0070062	extracellular exosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8glp, PDBe:8glp, PDBj:8glp
PDBsum	8glp
PubMed	37020024
UniProt	P62280\|RS11_HUMAN Small ribosomal subunit protein uS17 (Gene Name=RPS11)