Structure of PDB 8fku Chain SL

Receptor sequence

>8fkuSL (length=243) Species: 9606 (Homo sapiens)

QLDKEQVRKAVDALLTHCKSRKNNYGLLLNENESLFLMVVLWKIPSKELR
VRLTLPHSIRSDSEDICLFTKDEPNSTPEKTEQFYRKLLNKHGIKTVSQI
ISLQTLKKEYKSYEAKLRLLSSFDFFLTDARIRRLLPSLIGRHFYQRKKV
PVSVNLLSKNLSREINDCIGGTVLNISKSGSCSAIRIGHVGMQIEHIIEN
IVAVTKGLSEKLPEKWESVKLLFVKTEKSAALPIFSSFVSNWD

3D structure

• PDB: 8fku Principles of human pre-60 S biogenesis.
• Chain: SL
• Resolution: 2.82 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SL	R50 V69 V80 K100 D101 K136 K140 S141 Y142 E143 K145 R160 R162 R163 L164 S167 L168 G170 R171 H172 Y174 R176 K177 K188 S208 G209 C211 A213 K240 K249 K254 K257	R21 V40 V51 K71 D72 K107 K111 S112 Y113 E114 K116 R131 R133 R134 L135 S138 L139 G141 R142 H143 Y145 R147 K148 K159 S179 G180 C182 A184 K211 K220 K225 K228

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003730 mRNA 3'-UTR binding
• GO:0005515 protein binding
• GO:0045296 cadherin binding
• GO:0048027 mRNA 5'-UTR binding

Biological Process

• GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0001649 osteoblast differentiation
• GO:0032880 regulation of protein localization
• GO:0042981 regulation of apoptotic process
• GO:2000772 regulation of cellular senescence

Cellular Component

• GO:0005634 nucleus
• GO:0005694 chromosome
• GO:0005730 nucleolus
• GO:0016020 membrane

External links

• PDB: RCSB:8fku, PDBe:8fku, PDBj:8fku
• PDBsum: 8fku
• PubMed: 37410842
• UniProt: O76021|RL1D1_HUMAN Ribosomal L1 domain-containing protein 1 (Gene Name=RSL1D1)