Structure of PDB 7wtm Chain SL

Receptor sequence

>7wtmSL (length=146) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

STELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEG
SYIDKKCPFTGLVSIRGKILTGTVVSTKMHRTIVIRRAYLHYIPKYNRYE
KRHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVVKVSAAAG

3D structure

PDB

7wtm In vitro structural maturation of an early stage pre-40S particle coupled with U3 snoRNA release and central pseudoknot formation.

Chain

Resolution

3.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SL	E10 P17 H18 F20 T27 W34 N37 G39 L40 K57 S65 I66 R67 K69 S77 M80 T83 R88 Y90 H92 K96 Y97 K102 R103 H104 K105 N106 Q127 R129 P130 I131 S132 K133 T134 R136 F137	E9 P16 H17 F19 T26 W33 N36 G38 L39 K56 S64 I65 R66 K68 S76 M79 T82 R87 Y89 H91 K95 Y96 K101 R102 H103 K104 N105 Q126 R128 P129 I130 S131 K132 T133 R135 F136

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0030686	90S preribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7wtm, PDBe:7wtm, PDBj:7wtm
PDBsum	7wtm
PubMed	36263816
UniProt	P0CX47\|RS11A_YEAST Small ribosomal subunit protein uS17A (Gene Name=RPS11A)