Structure of PDB 6xa1 Chain SL

Receptor sequence

>6xa1SL (length=140) Species: 9606 (Homo sapiens) [Search protein sequence]

ADIQTERAYQKQPTIFQNKKKLPRYYKNIGLGFKTPKEAIEGTYIDKKCP
FTGNVSIRGRILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSV
HLSPCFRDVQIGDIVTVGECRPLSKTVRFNVLKVTKAAGT

3D structure

PDB

6xa1 Selective inhibition of human translation termination by a drug-like compound.

Chain

Resolution

2.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SL	A2 D3	A1 D2
BS02	rna	SL	E7 R8 T15 F17 K20 Y36 N39 G41 L42 K59 S67 I68 R69 R71 K79 K81 M82 Q83 V87 R89 R90 Y92 H94 R97 K98 K104 R105 H106 K107 N108 E130 R132 P133 S135 K136 T137 R139 F140	E6 R7 T14 F16 K19 Y25 N28 G30 L31 K48 S56 I57 R58 R60 K68 K70 M71 Q72 V76 R78 R79 Y81 H83 R86 K87 K93 R94 H95 K96 N97 E119 R121 P122 S124 K125 T126 R128 F129

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042274	ribosomal small subunit biogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0005925	focal adhesion
GO:0016020	membrane
GO:0022626	cytosolic ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0032040	small-subunit processome
GO:0045202	synapse
GO:0070062	extracellular exosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6xa1, PDBe:6xa1, PDBj:6xa1
PDBsum	6xa1
PubMed	33009412
UniProt	P62280\|RS11_HUMAN Small ribosomal subunit protein uS17 (Gene Name=RPS11)