Structure of PDB 8fl0 Chain SK

Receptor sequence

>8fl0SK (length=244) Species: 9606 (Homo sapiens) [Search protein sequence]

MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVH
ASIAGCRIIGRMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEER
LSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGS
YCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVN
DWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSL

3D structure

PDB

8fl0 Principles of human pre-60 S biogenesis.

Chain

Resolution

2.91 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	SK	E8 N9 N33	E8 N9 N33

Gene Ontology

	Molecular Function
GO:0003743	translation initiation factor activity
GO:0005515	protein binding
GO:0043022	ribosome binding
GO:0043023	ribosomal large subunit binding

	Biological Process
GO:0000054	ribosomal subunit export from nucleus
GO:0000460	maturation of 5.8S rRNA
GO:0000470	maturation of LSU-rRNA
GO:0006110	regulation of glycolytic process
GO:0006412	translation
GO:0006413	translational initiation
GO:0032868	response to insulin
GO:0035195	miRNA-mediated post-transcriptional gene silencing
GO:0035278	miRNA-mediated gene silencing by inhibition of translation
GO:0042254	ribosome biogenesis
GO:0042256	cytosolic ribosome assembly
GO:0042273	ribosomal large subunit biogenesis
GO:0042304	regulation of fatty acid biosynthetic process
GO:0045652	regulation of megakaryocyte differentiation
GO:0045727	positive regulation of translation
GO:1902626	assembly of large subunit precursor of preribosome
GO:2000377	regulation of reactive oxygen species metabolic process

	Cellular Component
GO:0005634	nucleus
GO:0005638	lamin filament
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005882	intermediate filament
GO:0030687	preribosome, large subunit precursor
GO:0045202	synapse
GO:0070062	extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8fl0, PDBe:8fl0, PDBj:8fl0
PDBsum	8fl0
PubMed	37410842
UniProt	P56537\|IF6_HUMAN Eukaryotic translation initiation factor 6 (Gene Name=EIF6)

[Back to BioLiP]