Structure of PDB 7n2v Chain SK

Receptor sequence
>7n2vSK (length=119) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
RVRKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTP
FAAQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNI
TDVTPIPHNGCRPPKKRRV
3D structure
PDB7n2v Structural basis of early translocation events on the ribosome.
ChainSK
Resolution2.54 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna SK H22 N28 N29 T33 G39 N40 A41 W44 T46 G48 G49 R53 G54 S55 K57 K87 P115 I116 P117 H118 N119 G120 C121 R122 P124 K125 R127 R128 H12 N18 N19 T23 G29 N30 A31 W34 T36 G38 G39 R43 G44 S45 K47 K77 P105 I106 P107 H108 N109 G110 C111 R112 P114 K115 R117 R118
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7n2v, PDBe:7n2v, PDBj:7n2v
PDBsum7n2v
PubMed34234344
UniProtP0A7R9|RS11_ECOLI Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]