Structure of PDB 7d5s Chain SK

Receptor sequence
>7d5sSK (length=171) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
YSTPKRPYESSRLDAELKLAGEFGLKNKKEIYRISFQLSKIRRAARDLLT
RDEKDPKRLFEGNALIRRLVRVGVLSEDKKKLDYVLALKVEDFLERRLQT
QVYKLGLAKSVHHARVLITQRHIAVGKQIVNIPSFMVRLDSEKHIDFAPT
SPFGGARPGRVARRNAARKAE
3D structure
PDB7d5s Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
ChainSK
Resolution4.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna SK P18 N38 K39 R44 S121 H124 R126 Q131 H133 P144 S145 P163 G170 R171 V172 A173 R175 N176 P7 N27 K28 R33 S110 H113 R115 Q120 H122 P133 S134 P152 G159 R160 V161 A162 R164 N165
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0006412 translation
GO:0042254 ribosome biogenesis
GO:0042274 ribosomal small subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:0030686 90S preribosome
GO:0032040 small-subunit processome
GO:0043226 organelle
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7d5s, PDBe:7d5s, PDBj:7d5s
PDBsum7d5s
PubMed
UniProtO13516|RS9A_YEAST Small ribosomal subunit protein uS4A (Gene Name=RPS9A)

[Back to BioLiP]