Structure of PDB 4v3p Chain SK

Receptor sequence
>4v3pSK (length=119) Species: 4565 (Triticum aestivum) [Search protein sequence]
IFASFNDTFIHVTDLSGRETLVRITGGMKVKADRDESSPYAAMLASQDVA
QRCKELGITALHIKLRATGGNKTKTPGPGAQSALRALARSGMKIGRIEDV
TPVPTDSTRRKGGRRGRRL
3D structure
PDB4v3p The molecular structure of the left-handed supra-molecular helix of eukaryotic polyribosomes.
ChainSK
Resolution34.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna SK H42 L46 R49 T51 M59 K62 D64 R65 D66 E67 Y71 A72 A73 V134 T136 D137 G143 H11 L15 R18 T20 M28 K31 D33 R34 D35 E36 Y40 A41 A42 V103 T105 D106 G112
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 17:34:50 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v3p', asym_id = 'SK', title = 'The molecular structure of the left-handed supra-molecular helix of eukaryotic polyribosomes.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v3p', asym_id='SK', title='The molecular structure of the left-handed supra-molecular helix of eukaryotic polyribosomes.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v3p', asym_id = 'SK'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v3p', asym_id='SK')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>