Structure of PDB 8rxh Chain SJ

Receptor sequence
>8rxhSJ (length=129) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]
TMMSVLANALRTIASAERRGKRQVLIRPSSKVVVKFLQVMQKHGYIGEFE
IIDDHRAGKIVVNLNGRLNKCGAICPRFDCATTDYEKWMKNILPSRQFGF
VVLTTSLGIMDHEEARSRNTGGKVLGFFY
3D structure
PDB8rxh Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
ChainSJ
Resolution2.93 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna SJ T2 M3 M4 V6 N9 R12 R19 R20 R28 S31 K32 R57 A58 K60 N70 K71 A74 I75 C76 R78 D80 A82 T83 K91 T105 T106 S107 N120 G122 Y130 T1 M2 M3 V5 N8 R11 R18 R19 R27 S30 K31 R56 A57 K59 N69 K70 A73 I74 C75 R77 D79 A81 T82 K90 T104 T105 S106 N119 G121 Y129
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rxh, PDBe:8rxh, PDBj:8rxh
PDBsum8rxh
PubMed38722744
UniProtQ4QGW3

[Back to BioLiP]